货号: | 10101 |
CAS号: | 10101 |
供应商: | NewEastBio |
数量: | 30000 |
英文名: | Rac1 Protein |
保质期: | 一年 |
保存条件: | -20℃ |
规格: | 100μl |
Catalog Number: 10101 |
Product Name: Rac1 Protein |
Synonyms: Ras-related C3 botulinum toxin substrate 1, Rac-1, p21-Rac1, MIG5, TC-25 |
Source: Human, recombinant full length, His6-tag |
Expression Host: E. coli |
Molecular Weight: 21 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Small GTPases are a super-family of cellular signaling regulators. Rac belongs to the Rho sub-family of GTPases that regulate cell motility, cell division, and gene transcription. GTP binding increases the activity of Rac, and the hydrolysis of GTP to GDP renders it inactive. GTP hydrolysis is aided by GTPase activating proteins (GAPs), while exchange of GDP for GTP is facilitated by guanine nucleotide exchange factors (GEFs). |
Amino Acid Sequence (1-192) |
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRL RPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKL TPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rac1 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
References: 1. Aznar Benitah, S. et al., Science 309: 933-935, 2005. 2. Chuang, Y. et al., Cancer Res. 64: 8271-8275, 2004. 3. Halet, G. et al., Dev. Cell 12: 309-317, 2007. 4. Machacek, M. et al., Nature 461: 99-103, 2009. 5. Matos, P. et al., Biochem. Biophys. Res. Commun. 277: 741-751, 2000. 6. Moore, K. A. et al., Biochem. J. 326: 17-20, 1997. 7. Walmsley, M. J. et al., Science 302: 459-462, 2003. 8. Wu, Y. I. et al., Nature 461: 104-108, 2009. |
Datasheet: |
Publications: |
1. Phosphorylation of α-tubulin by protein kinase C stimulates microtubule dynamics in human breast cells Cytoskeleton Volume 71, Issue 4, pages 257–272, April 2014 |
2. Immunofluorescence and Confocal Microscopy of Neutrophils Neutrophil Methods and Protocols Methods in Molecular Biology Volume 1124, 2014, pp 251-268 |
3. A link between the nuclear-localized srGAP3 and the SWI/SNF chromatin remodeler Brg1 Molecular and Cellular Neuroscience Volume 60, May 2014, Pages 10–25 |
4. SHP2 Phosphatase Promotes Mast Cell Chemotaxis toward Stem Cell Factor via Enhancing Activation of the Lyn/Vav/Rac Signaling Axis The Journal of Immunology April 14, 2014 1301155 |
5. ROBO1, a tumor suppressor and critical molecular barrier for localized tumor cells to acquire invasive phenotype: Study in African-American and Caucasian prostate cancer models International Journal of Cancer Volume 135, Issue 11, pages 2493–2506, 1 December 2014 |
6. Transcription factors NRF2 and nf-kb are coordinated effectors of the RHO family, GTP binding protein rac1 during inflammation J Biol Chem. 2014 May 30;289(22):15244-58 |
7. Canonical and Non-canonical G-protein Signaling Helps Coordinate Actin Dynamics to Promote Macrophage Phagocytosis of Zymosan Mol Cell Biol. 2014 Nov 15;34(22):4186-99 |
8. p53 Down Regulates PDGF-Induced Formation of Circular Dorsal Ruffles in Rat Aortic Smooth Muscle Cells PLoS One. 2014 Sep 23;9(9):e108257 |
9. LPA-mediated migration of ovarian cancer cells involves translocalization of Gαi2 to invadopodia and association with Src and β-pix Cancer Lett. 2015 Jan 28;356(2 Pt B):382-91 |
10. cAMP controls the restoration of endothelial barrier function after thrombin-induced hyperpermeability via Rac1 activation Physiological ReportsPublished 24 October 2014Vol. 2no. e12175DOI: 10.14814/phy2.12175 |
11. Cisplatin at Sub-toxic Levels Mediates Integrin Switch in Lung Cancer Cells Anticancer Research December 2014 vol. 34 no. 12 7111-7117 |
12. Semaphorin-3F suppresses the stemness of colorectal cancer cells by inactivating Rac1 Cancer letters. March 1, 2015Volume 358, Issue 1, Pages 76–84. |
13. Geometry sensing through POR1 regulates Rac1 activity controlling early osteoblast differentiation in response to nanofiber diameter Integr Biol (Camb). 2014 Dec 24 |
14. Inhibition of Rac1 Activity in the Hippocampus Impairs the Forgetting of Contextual Fear Memory Mol Neurobiol. 2015 Jan 24 |